Protein coding transcript 130592

• Transcript: Ll_transcript_78020
• CDS coordinates: 2-385 (+)
• Peptide sequence: TIPISDALPNLEELSIDYSIDLVELPAELCKITTLKKLSITKCGKFSILPREIGNLVNLEMLRLSSCSVLGELPSSIGMLDKLGYLDISYCYSLPSLPEEIGELGNLRKLHMTGCTWCKLPMSVIKLE
• ORF Type: internal

Annotations of Ll_transcript_78020

• Blastp: Probable disease resistance protein At5g66900 from Arabidopsis with 51.97% of identity
• Blastx: Probable disease resistance protein At5g66900 from Arabidopsis with 51.97% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT5G66900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433265.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;