Protein coding transcript 130594

• Transcript: Ll_transcript_78030
• CDS coordinates: 1-594 (+)
• Peptide sequence: QGFSTGDLDKDAVALRIFLEDEHLIGCAQTFAKNMGLFGHKVGCLSVVCQDIKQAATVKSQLQKIAHSMYSSPHIHGILLVTMILSDPDMKTLWRKEINVMAKRIQTMRSSLRQSLENLDSSFNWEHITTQGGMFCFSGLTADQVKLLEKLFHIYMTPDGRISMAAVTTSNVKYLANAIHHVTRIDEEALTACNNRF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_78030

• Blastp: Aspartate aminotransferase, mitochondrial from Arabidopsis with 61.96% of identity
• Blastx: Aspartate aminotransferase, mitochondrial from Arabidopsis with 61.96% of identity
• Eggnog: aminotransferase(COG1448)
• Kegg: Link to kegg annotations (AT2G30970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462770.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;