Transcript | Ll_transcript_78027 |
---|---|
CDS coordinates | 3-359 (+) |
Peptide sequence | VTNEIFELSKKIKEFKYVPDLKTCGLIETIGVTTFKVDGRDFVVEVIDSVENYVNLMKDIFDFAKIKKLVNQPFNILIDSMHGVTGRYVEKIFVEELGADVNKNVTHTETLEDFGGEHP |
ORF Type | internal |
Blastp | Phosphoglucomutase from Sophophora with 48.78% of identity |
---|---|
Blastx | Phosphoglucomutase from Sophophora with 48.78% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (Dsimw501_GD27676) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003630886.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer