Protein coding transcript 130597

• Transcript: Ll_transcript_266272
• CDS coordinates: 1-348 (+)
• Peptide sequence: NCYIVGRDPAGVPHPEGKEASPDGNLFESTHGSRVLKMAPGLETLEIIPFRVAAYDIVNRKMTFFQPERKEQFDFISGTKMRKFARTGEEPPEGFMVTKAWQIISDYYQSIINNN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_266272

• Blastp: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 from Mus with 60% of identity
• Blastx: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 from Mus with 60% of identity
• Eggnog: Catalyzes the synthesis of activated sulfate (By similarity)(COG0529)
• Kegg: Link to kegg annotations (23972)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427328.1)
• Pfam: ATP-sulfurylase (PF01747.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;