Protein coding transcript 130598

• Transcript: Ll_transcript_266283
• CDS coordinates: 71-466 (+)
• Peptide sequence: MYVAQQSGGATPPKAGWQGYKKGGIGAKNMRTKAPPKPQQLHYCDVCKISCAGPQTYREHLEGQKHKKREAATKMAASVATTSQNRAGNSLRCQLCDVTCTGNDAYAAHIRGAKHQKVVLLHTKLGKPIPSQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_266283

• Blastp: Zinc finger RNA-binding protein from Silurana with 75.27% of identity
• Blastx: Zinc finger RNA-binding protein from Silurana with 75.27% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (496597)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020985680.1)
• Pfam: Zinc-finger double-stranded RNA-binding (PF12171.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;