Protein coding transcript 130599

• Transcript: Ll_transcript_266266
• CDS coordinates: 3-431 (+)
• Peptide sequence: YDGLSATQDYSKGSGGYTGGDSGAQTGSKAGVGTNAPSTGSSTTDIFNKAHVALSKVNSYDKGFHSGTPPPFNLAGNQNTGMAPSGAFPTQLYIPPPMPQHHSTTLMQHPVHQQMDMRNTSRRSESGNNSGQRSQSSAQSNKP
• ORF Type: internal

Annotations of Ll_transcript_266266

• Blastp: Protein lingerer from Sophophora with 44.62% of identity
• Blastx: Protein lingerer from Sophophora with 46.07% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (Dpse_GA21277)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020994397.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;