| Transcript | Ll_transcript_266267 |
|---|---|
| CDS coordinates | 3-479 (+) |
| Peptide sequence | YDGLSATQDYSKGSGGYTGGDSGAQTGSKAGVGTNAPSTGSSTTDIFNKAHVALSKVNSYDKGFHSGTPPPFNLAGNQNTGMAPSGAFPTQLYIPPPMPQHHSTTLMQHPGVHQQMDMRNTSRRSESGNNSGQRSQSSAQSNKPGSKQVYPQQNYWQN* |
| ORF Type | 5prime_partial |
| Blastp | Protein lingerer from Sophophora with 45.04% of identity |
|---|---|
| Blastx | Protein lingerer from Stegomyia with 45.65% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (Dpse_GA21277) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020215623.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer