Protein coding transcript 130603

• Transcript: Ll_transcript_266275
• CDS coordinates: 56-877 (+)
• Peptide sequence: MGSLRFSFSFWNNNPKPPTPHSSRPFSPFAVALGITAGAATAFTLLISSKHDPLKPVPLWGSITMADNALPVTQSKNGSSFPSSILTDSLNLLGIGFRRKSIFGLKSIDVYAFGVYADNNDVKNYLAEKYGALSGSQLKGNKEFIQDVLENDISITVRLQILYGKLSIRSVRNAFEESVGTRLQKYGGSDNKELLQRFTSLFKDDIKIPSGSVIHLSRGKGHVLSISIDGQEVGSIESQLLCKSLLDLYIGDEPFDKKAKEEIELNLASHLQN*
• ORF Type: complete

Annotations of Ll_transcript_266275

• Blastp: Fatty-acid-binding protein 1 from Arabidopsis with 54.45% of identity
• Blastx: Fatty-acid-binding protein 1 from Arabidopsis with 54.26% of identity
• Eggnog: Chalcone-flavanone isomerase(ENOG410Y0PD)
• Kegg: Link to kegg annotations (AT3G63170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457073.1)
• Pfam: Chalcone-flavanone isomerase (PF02431.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;