Protein coding transcript 130607

• Transcript: Ll_transcript_266305
• CDS coordinates: 2-367 (+)
• Peptide sequence: ILLSELSRRRIRSINKLIRVGKTEPVVVIRVDKEKGYIDLSKRRVSPEDVEKCTERFSKAKAVNSILRHVAELLHYETDEQLEELYQKTAWHLEETRKSSAYDAFKQAVLDPSILAECGLDE
• ORF Type: internal

Annotations of Ll_transcript_266305

• Blastp: Eukaryotic translation initiation factor 2 subunit 1 from Sophophora with 77.24% of identity
• Blastx: Eukaryotic translation initiation factor 2 subunit 1 from Sophophora with 74.31% of identity
• Eggnog: translation initiation factor(COG1093)
• Kegg: Link to kegg annotations (Dmel_CG9946)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003600967.1)
• Pfam: S1 RNA binding domain (PF00575.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;