Protein coding transcript 130609

• Transcript: Ll_transcript_62598
• CDS coordinates: 1-378 (+)
• Peptide sequence: EELKHLSVPCSDSKAITQVGTISANADEKVGSLIAEAMEKVGNDGVITVEEGTGLQDELEVVKGMQFDRGYLSPYFINKPETGIVELENPYILMADKKISNVREMLPILESVAKSGKPLLIISEDL
• ORF Type: internal

Annotations of Ll_transcript_62598

• Blastp: 60 kDa chaperonin from Buchnera with 100% of identity
• Blastx: 60 kDa chaperonin from Buchnera with 100% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (BUAPTUC7_019)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006583012.1)
• Pfam: TCP-1/cpn60 chaperonin family (PF00118.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;