Protein coding transcript 130613

• Transcript: Ll_transcript_197951
• CDS coordinates: 3-551 (+)
• Peptide sequence: ETYKIWNDIIKIPSERIIRIGDKNKEKYNSENFWQMGDTGPCGPCTEIFYDYSDTMKIDPIEFLENKNGRFVEIWNIVFIEFNRISKTKIISLKNKSIDTGMGLERISAVLQNVYSNYHIDVFQKLIKNIAQLSSINNLDHISFQVIADHIRSCSYIIADNILPSNEHRGYILRRIIRRALRH
• ORF Type: internal

Annotations of Ll_transcript_197951

• Blastp: Alanine--tRNA ligase from Buchnera with 100% of identity
• Blastx: Alanine--tRNA ligase from Buchnera with 100% of identity
• Eggnog: Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction alanine is first activated by ATP to form Ala- AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged Ser-tRNA(Ala) and Gly-tRNA(Ala) via its editing domain (By similarity)(COG0013)
• Kegg: Link to kegg annotations (BU403)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004505726.1)
• Pfam: tRNA synthetases class II (A) (PF01411.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;