Protein coding transcript 130614

• Transcript: Ll_transcript_197946
• CDS coordinates: 85-1137 (+)
• Peptide sequence: MFSLFTMPLIKVSFLVITFLSAATFSKANPGFHFGWNGHGGNRDISFGLSPQFYQFSCPQTNDIVMSVLEKAISKDMRVAASLLRLHFHDCFVQGCDASILLDNSAKILSEKNSKPNKNSIRGLEVIDEIKSKLEEACPQTVSCADIVALAARGSTVLSGGPNWELPLGRRDSKTASLNGSNNHIPPPNATIEKLITFFKRQGLDEVDLVALSGAHTIGVARCATFKQRLYNQNGNNQPDQNLEKSFFFDLKNVCPKSGADNRISPLDFGSPSMFDNTYFKLILRGKGLLNSDEVLLTGSVKETQELVKKYAQDESLFFEQFAMSMTKMGNLRPLTGFNGEVRKNCRRVN*
• ORF Type: complete

Annotations of Ll_transcript_197946

• Blastp: Peroxidase 9 from Arabidopsis with 70% of identity
• Blastx: Peroxidase 9 from Arabidopsis with 73.84% of identity
• Eggnog: peroxidase(ENOG410YFB5)
• Kegg: Link to kegg annotations (AT1G44970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436877.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;