Protein coding transcript 130618

• Transcript: Ll_transcript_197940
• CDS coordinates: 79-681 (+)
• Peptide sequence: MIITLHLKLLLLFIFISSLTNTSKLVFAKEQYNVSEVCKVTRYPSLCIHSLEPFSLSEGRSLSNWARVGVSVTIGEVKSVQAYLTRLKRQGHFKGRNKVALLDCIETFQYALDELHSSLSVLRRLSKSTFSTQMGDLNAWLSAALTDEDTCLDGFEGNKERKIKLLRNQVLKAYYITSNALALVNKLATTGLGSISDLDP*
• ORF Type: complete

Annotations of Ll_transcript_197940

• Blastp: Pectinesterase inhibitor 6 from Arabidopsis with 43.68% of identity
• Blastx: Pectinesterase inhibitor 6 from Arabidopsis with 43.68% of identity
• Eggnog: Invertase pectin methylesterase inhibitor(ENOG4111A69)
• Kegg: Link to kegg annotations (AT2G47670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439168.1)
• Pfam: Plant invertase/pectin methylesterase inhibitor (PF04043.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;