Protein coding transcript 130619

• Transcript: Ll_transcript_197931
• CDS coordinates: 2-307 (+)
• Peptide sequence: KWGVGQGVLEQNILKSNCSDNFAVSAVNYNYSDSGLFGFLLAYNGKDVSNVLKAAVQSLRSPTVTETEVSRAKKQLIFSLVSASESSAGVLENITYQAATTG
• ORF Type: internal

Annotations of Ll_transcript_197931

• Blastp: Cytochrome b-c1 complex subunit 2, mitochondrial from Bos with 36.9% of identity
• Blastx: Cytochrome b-c1 complex subunit 2, mitochondrial from Bos with 36.9% of identity
• Eggnog: peptidase'(COG0612)
• Kegg: Link to kegg annotations (282394)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020238495.1)
• Pfam: Peptidase M16 inactive domain (PF05193.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;