| Transcript | Ll_transcript_4679 |
|---|---|
| CDS coordinates | 60-422 (+) |
| Peptide sequence | MTKPIVSFLFLFPLFLLFNSGGYLNFAEGVVVEKTWCIAKYTSNDAQLNNNILYACNDIKDCMMIQEGGSCFNPNNLIGHASAAMNQYYANNGRNPWNCDFSGTGLIVITDPSYDSCKFD* |
| ORF Type | complete |
| Blastp | Major pollen allergen Ole e 10 from Olea with 52.87% of identity |
|---|---|
| Blastx | Major pollen allergen Ole e 10 from Olea with 52.87% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019447872.1) |
| Pfam | X8 domain (PF07983.12) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer