| Transcript | Ll_transcript_19688 |
|---|---|
| CDS coordinates | 169-516 (+) |
| Peptide sequence | MVQLNMRLNQLPQRDENGNWQTGSIATMIDIIGSLAVHSVSPMFNVSVDFSMSFYSTAKFQEEVEIKAKVIGKKEKLTSVVVDIRKKNNGEIIATGKQWMSSTNINANRYQNSKL* |
| ORF Type | complete |
| Blastp | Acyl-coenzyme A thioesterase 13 from Mus with 32.14% of identity |
|---|---|
| Blastx | - |
| Eggnog | thioesterase Superfamily protein(COG2050) |
| Kegg | Link to kegg annotations (66834) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019448154.1) |
| Pfam | Thioesterase superfamily (PF03061.21) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer