Protein coding transcript 130639

• Transcript: Ll_transcript_19690
• CDS coordinates: 2-328 (+)
• Peptide sequence: CPIRQLSDGQRCRVVFAYLAWQTPHLLLLDEPTNHLDMETIDSLADAINHFDGGMVLVSHDFRLISQVAEEIWICENGKATKWQSTILDYKEHLKKKILKNNNDSASNK
• ORF Type: internal

Annotations of Ll_transcript_19690

• Blastp: ATP-binding cassette sub-family F member 2 from Mus with 72.45% of identity
• Blastx: ATP-binding cassette sub-family F member 2 from Mus with 72.45% of identity
• Eggnog: (ABC) transporter(COG0488)
• Kegg: Link to kegg annotations (27407)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004487070.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;