Transcript | Ll_transcript_19690 |
---|---|
CDS coordinates | 2-328 (+) |
Peptide sequence | CPIRQLSDGQRCRVVFAYLAWQTPHLLLLDEPTNHLDMETIDSLADAINHFDGGMVLVSHDFRLISQVAEEIWICENGKATKWQSTILDYKEHLKKKILKNNNDSASNK |
ORF Type | internal |
Blastp | ATP-binding cassette sub-family F member 2 from Mus with 72.45% of identity |
---|---|
Blastx | ATP-binding cassette sub-family F member 2 from Mus with 72.45% of identity |
Eggnog | (ABC) transporter(COG0488) |
Kegg | Link to kegg annotations (27407) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004487070.1) |
Pfam | ABC transporter (PF00005.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer