Protein coding transcript 130640

• Transcript: Ll_transcript_19666
• CDS coordinates: 2-457 (+)
• Peptide sequence: YALGLIHANHGAAINDYLLGQLKDAHNEIVKHGGCLGIGLSAMGTSREDIYEQLKFNMYQDDAVTGEAAGLAMGLVMLGSKNGEALQDMVAYAQVTQHEKILRGLAVGISFVMYGRLEEADPLITSLLQDEDPILRRSAMCTISMAYCGTGS
• ORF Type: internal

Annotations of Ll_transcript_19666

• Blastp: 26S proteasome non-ATPase regulatory subunit 1 from Mus with 74.34% of identity
• Blastx: 26S proteasome non-ATPase regulatory subunit 1 from Mus with 74.34% of identity
• Eggnog: 26s proteasome(COG5116)
• Kegg: Link to kegg annotations (70247)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013447374.1)
• Pfam: Proteasome/cyclosome repeat (PF01851.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;