Protein coding transcript 130643

• Transcript: Ll_transcript_19671
• CDS coordinates: 2-511 (+)
• Peptide sequence: KDIRPPPCEIDYKGMRFLITDRPNDQIIHNYVAELKRHNVKHVVRVCEPTYKIDELKAEGIMVTDLAYDDGTSPANELIEEWFELLRNQFRTDEGSCVAVHCVAGLGRAPVLVALALIELGLKYEDAVQLIREKRRGAINSKQLAFLEKYRPKSKLKMKNGHKSTCCIQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_19671

• Blastp: Protein tyrosine phosphatase type IVA 1 from Rattus with 57.74% of identity
• Blastx: Protein tyrosine phosphatase type IVA 1 from Rattus with 57.74% of identity
• Eggnog: protein tyrosine phosphatase type IVA(ENOG4111I7J)
• Kegg: Link to kegg annotations (100365697)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003621351.1)
• Pfam: Dual specificity phosphatase, catalytic domain (PF00782.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;