Protein coding transcript 130647

• Transcript: Ll_transcript_19634
• CDS coordinates: 3-431 (+)
• Peptide sequence: QSYLYVIEAMTRKKVKLVYISDDNARKATFKKRKKGIMKKVEVWPDPKGVKQIIKRYQKSSVIDETKNMNQESFVMQTISKAMYKLDKHRKENREKEMNIAMFDYMESRKVPENMTITDLRNMDKLIQEYISDIRNKIDQIA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_19634

• Blastp: Agamous-like MADS-box protein AGL80 from Arabidopsis with 36.36% of identity
• Blastx: Agamous-like MADS-box protein AGL80 from Arabidopsis with 36.36% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT5G48670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427465.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;