Protein coding transcript 130652

• Transcript: Ll_transcript_19686
• CDS coordinates: 3-386 (+)
• Peptide sequence: LDLVTTDIFNIPQTLRPLSRVMTDPGIISDVNGDKQSNENDSEYHHKMIIVAIFLPINARKDNLSGKWCFTYDEDSIFWQLKHGISSDTQVVYVGSLKVDIDVSEQEEVAAQLLEDFNCVPTFIPPDL
• ORF Type: internal

Annotations of Ll_transcript_19686

• Blastp: Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 from Arabidopsis with 50.76% of identity
• Blastx: Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 from Arabidopsis with 50.76% of identity
• Eggnog: synthase(COG0380)
• Kegg: Link to kegg annotations (AT1G23870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430358.1)
• Pfam: Glycosyltransferase family 20 (PF00982.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;