Transcript | Ll_transcript_19686 |
---|---|
CDS coordinates | 3-386 (+) |
Peptide sequence | LDLVTTDIFNIPQTLRPLSRVMTDPGIISDVNGDKQSNENDSEYHHKMIIVAIFLPINARKDNLSGKWCFTYDEDSIFWQLKHGISSDTQVVYVGSLKVDIDVSEQEEVAAQLLEDFNCVPTFIPPDL |
ORF Type | internal |
Blastp | Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 from Arabidopsis with 50.76% of identity |
---|---|
Blastx | Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 from Arabidopsis with 50.76% of identity |
Eggnog | synthase(COG0380) |
Kegg | Link to kegg annotations (AT1G23870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430358.1) |
Pfam | Glycosyltransferase family 20 (PF00982.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer