| Transcript | Ll_transcript_232358 |
|---|---|
| CDS coordinates | 2-373 (+) |
| Peptide sequence | SHCNMCDLKFLGKILAHRKTEGHQRLKRYLHPNCNMCEKEFPSRMEWVEHRLTPEHLRTMSTAIEKKTGDGEIIIKEEELDIEPLLEEPLQLEVENPILELSDDVSGLQNIIPAFKKDRKVSTQ |
| ORF Type | internal |
| Blastp | Zinc finger protein on ecdysone puffs from Sophophora with 49.3% of identity |
|---|---|
| Blastx | Zinc finger protein on ecdysone puffs from Sophophora with 50% of identity |
| Eggnog | ZnF_C2H2(ENOG4111SKG) |
| Kegg | Link to kegg annotations (Dmel_CG6143) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017430466.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer