Protein coding transcript 130658

• Transcript: Ll_transcript_98082
• CDS coordinates: 145-891 (-)
• Peptide sequence: MEFDFSNEFKQGKDNVAVDTLSRREEGECLALVVHDIQSDILERIKSTWVSDSGLAKIISQLQVHSASHKHYTWNGSELRRKGRLVVGQNLALRQELLHWFHNAATGGHSGKNATTKRIKFVLYWKGLNEDVKQLIQQCQVCQQCKYDISATPGLLQPLSIPGHVWKHITMDFIEGLPNSQGKQVIFVVVDRLSKAAHFMSLSHPYTASIVTQSFMDNVFKRHGFPDSITSDRHPIFISQFWQDLMPF*
• ORF Type: complete

Annotations of Ll_transcript_98082

• Blastp: Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 29.21% of identity
• Blastx: Transposon Tf2-9 polyprotein from Schizosaccharomyces with 29.58% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YIL082W-A)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414654.1)
• Pfam: His(2)-Cys(2) zinc finger (PF09337.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;