Protein coding transcript 130659

• Transcript: Ll_transcript_98095
• CDS coordinates: 3-578 (+)
• Peptide sequence: EEALREEAGYYAVPKIEIDETLREIKELAQKIRDRKIINRNESRISRQSNKPTTPRTAPAQARGRSATDFRSRMEDLGVDMEDTDEAHFTKTRGRARSLTRSQSRTNAKKPRLGSMHRSVSTSRSQSRVPRNQSGVRDSSMQLKLKQVAHKAIAKKVKKQGLKGEADRFIGTKRPKHLFAGKRGIGKTERR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_98095

• Blastp: Nucleolar GTP-binding protein 1 from Sophophora with 44.5% of identity
• Blastx: Nucleolar GTP-binding protein 1 from Sophophora with 42.93% of identity
• Eggnog: Involved in the biogenesis of the 60S ribosomal subunit (By similarity)(COG1084)
• Kegg: Link to kegg annotations (Dmel_CG8801)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016182700.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;