Transcript | Ll_transcript_98097 |
---|---|
CDS coordinates | 1-297 (-) |
Peptide sequence | REYPDLLEGGLATLKLHEIDVEDEKDEERDLNEKVWNEIKKRVEAIKSILGSMEDGEITVSAYDTAWVALVEDVNGSGAPQFPSTLEWIAKNQIPDGSW |
ORF Type | internal |
Blastp | Ent-copalyl diphosphate synthase, chloroplastic from Pisum with 58.25% of identity |
---|---|
Blastx | Ent-copalyl diphosphate synthase, chloroplastic from Pisum with 58.25% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426486.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer