Protein coding transcript 130668

• Transcript: Ll_transcript_82760
• CDS coordinates: 99-914 (+)
• Peptide sequence: MKAKMNGIISNLISCVIPLVVLSLVVCSEARFLLVNAPGDGFVQSKGTEFVLNGSPFLFNGFNSYWMMNVAADPNQRSKVSNVFRDASSVGLTVCRTWAFNDGGNQYLQLSPGIYNENMFQALDFVVAEAKKYGVRLILSLVNNYNDFGGRPQYVQWAKSSGVPVNNDDDFYTNPVIKGYYKNHVKRVLTRVNTITGIAYMNEPTIMAWELINEPRCQVDYSGKTINAWVQEMAPYVKSIDNKHLLELGLEGFYGDSSPDRKQYNPGFQVG*
• ORF Type: complete

Annotations of Ll_transcript_82760

• Blastp: Mannan endo-1,4-beta-mannosidase 5 from Lycopersicon with 67.56% of identity
• Blastx: Mannan endo-1,4-beta-mannosidase 5 from Lycopersicon with 67.56% of identity
• Eggnog: Mannan endo-1,4-beta-mannosidase(COG3934)
• Kegg: Link to kegg annotations (544170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003540598.1)
• Pfam: Cellulase (glycosyl hydrolase family 5) (PF00150.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;