Protein coding transcript 130674

• Transcript: Ll_transcript_82756
• CDS coordinates: 181-828 (+)
• Peptide sequence: MAVKVYGPTYASPKRVLVLLIEKEIEFETVDVDIFKGVHKDPEFLKLQPFGTLPVIQDGDYTLYESRAIIRYYAEKYKHQGTDLLGKTIEERGLVEQWLEVEAQNFHPPIFNLVINVLFAPLLGAPSDPKVIQESDEKLGKVLDIYEERLSKTKYLAGDFFSLADLSHLAFGHYLVNQTGRGHLVRDRKHVSAWWDDISSRPSWKKVLQLYKYPV*
• ORF Type: complete

Annotations of Ll_transcript_82756

• Blastp: Glutathione S-transferase F9 from Arabidopsis with 61.86% of identity
• Blastx: Glutathione S-transferase F9 from Arabidopsis with 61.86% of identity
• Eggnog: glutathione Stransferase(COG0625)
• Kegg: Link to kegg annotations (AT2G30860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440724.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF02798.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;