Protein coding transcript 130677

• Transcript: Ll_transcript_82793
• CDS coordinates: 1-600 (+)
• Peptide sequence: TMTKMAILGKGSMRNKEKEDEMRSSLNPKFAHLADELHVQVTAYAPPAEAYARLAYALAELRKFLIPDHNDQIAQEQAREMQQFGGAPPVRHPGPIIHAPPPPPAVIRQMPPQPPRMPRAPVPGKAKVMSILDRARSAMEGSNAYPGNGGYGDSGSSHYSHFDSGYGGVATYNGGGNDDYYSGNSYSQDNSQSGGGRGWN
• ORF Type: internal

Annotations of Ll_transcript_82793

• Blastp: KH domain-containing, RNA-binding, signal transduction-associated protein 3 from Homo with 50% of identity
• Blastx: KH domain-containing, RNA-binding, signal transduction-associated protein 2 from Mus with 57.47% of identity
• Eggnog: mRNA processing(COG5176)
• Kegg: Link to kegg annotations (10656)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003623654.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;