Protein coding transcript 130682

• Transcript: Ll_transcript_82783
• CDS coordinates: 2-406 (+)
• Peptide sequence: ALDLKDKGNAALAIGNYEQAIEHYTKAIELDPNNHVLFSNRSAAFAKQGKYQNALEDAEKTVSLKPDWPKGYSRKGTALSFLGRKDDAAKAYGDGLKFDPTNQQLLDGLREVKQSQPSFGGNNMFPTESFLKLAQ
• ORF Type: internal

Annotations of Ll_transcript_82783

• Blastp: Stress-induced-phosphoprotein 1 from Homo with 56.76% of identity
• Blastx: Stress-induced-phosphoprotein 1 from Homo with 56.76% of identity
• Eggnog: tetratricopeptide repeat domain(ENOG410XTCJ)
• Kegg: Link to kegg annotations (10963)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016188924.1)
• Pfam: Tetratricopeptide repeat (PF00515.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;