Protein coding transcript 130688

• Transcript: Ll_transcript_221926
• CDS coordinates: 3-482 (+)
• Peptide sequence: KGQNKSFAITNLFLFALFSLTLTTTYKIYFTMVFPKLASESDLFNLNSNVAFPYARNSLPRYSMPEMSMPKEAAYQNIHDELQLDANPKLNLASFVTTSMEEECNKLIMESINKKYVDMDEYPVTTELHNRCVNMIARLFNAKIGEDESAIGAGTVGSSE
• ORF Type: internal

Annotations of Ll_transcript_221926

• Blastp: Glutamate decarboxylase 4 from Arabidopsis with 72.09% of identity
• Blastx: Glutamate decarboxylase 4 from Arabidopsis with 72.09% of identity
• Eggnog: decarboxylase(COG0076)
• Kegg: Link to kegg annotations (AT2G02010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462664.1)
• Pfam: Pyridoxal-dependent decarboxylase conserved domain (PF00282.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;