Protein coding transcript 130692

• Transcript: Ll_transcript_221917
• CDS coordinates: 2-343 (+)
• Peptide sequence: DTLYEGIKQILKWIETKPFQKINAKLGVEPLPACKKHEFKSKDYWYCTLGQITYNMYHPVGSNPMGPNPKTSVVDHELKVHGIKNLRVADASVFPFTLSGHPVAPCVMIGDKLA
• ORF Type: internal

Annotations of Ll_transcript_221917

• Blastp: Glucose dehydrogenase [FAD, quinone] from Sophophora with 42.11% of identity
• Blastx: Glucose dehydrogenase [FAD, quinone] from Sophophora with 42.11% of identity
• Eggnog: oxidoreductase(COG2303)
• Kegg: Link to kegg annotations (Dmel_CG1152)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003612495.2)
• Pfam: GMC oxidoreductase (PF05199.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;