Protein coding transcript 130694

• Transcript: Ll_transcript_221890
• CDS coordinates: 1-333 (+)
• Peptide sequence: GDRNMILGKNAFFVTPSDSLAVIANNLECIPYFKKNGVKGFARSMPTAGAVDRVAQKLGKEFFETPTGWKYFGNLMDAERLSLCGEESFGTGSDHIREKDGIWAVLAWLQI
• ORF Type: internal

Annotations of Ll_transcript_221890

• Blastp: Phosphoglucomutase from Sophophora with 81.98% of identity
• Blastx: Phosphoglucomutase from Sophophora with 81.98% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (Dsimw501_GD27676)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014513407.1)
• Pfam: Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III (PF02880.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;