Protein coding transcript 130700

• Transcript: Ll_transcript_176556
• CDS coordinates: 330-770 (+)
• Peptide sequence: MDSVVDSINNAYQDFIAAAATVLEAKESAGAVKTTATDTALENFKQKWELFRVACDQAEEFVESAKQRIGSECLVDEATGPVAGRPGQSTTTGLSPISAVRLEQMSKAVHWLVIELQNGSGASASNAALSHPSAPFDARFSEDTAP*
• ORF Type: complete

Annotations of Ll_transcript_176556

• Blastp: Mediator of RNA polymerase II transcription subunit 32 from Arabidopsis with 64.24% of identity
• Blastx: Mediator of RNA polymerase II transcription subunit 32 from Arabidopsis with 64.9% of identity
• Eggnog: NA(ENOG4111V2K)
• Kegg: Link to kegg annotations (AT1G11760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454170.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;