Protein coding transcript 130705

• Transcript: Ll_transcript_176568
• CDS coordinates: 173-874 (+)
• Peptide sequence: MNFNNTSQIVTTILFYLTFSLFYLPKQLHAYDPVVKFSINCGSSGKSSDSARTWISDINSKLLLSHSVEASEAKTQSPSTTQVPYSTATLSSSQFTYSFPVTQGPNFLRLFFNPSSYLNFNRTNSMFTVESNGFTLLKDFNASLFADAEGSDVIFKEYIINVNDVQWLNLTFTPNMSFPNSYAFVNGIEVVSMPFDLYYNSAYSNNEGFKYVGSSSTLYKLSNNTAMETEYRY*
• ORF Type: complete

Annotations of Ll_transcript_176568

• Blastp: Receptor-like protein kinase FERONIA from Arabidopsis with 45.41% of identity
• Blastx: Receptor-like protein kinase FERONIA from Arabidopsis with 44.93% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G51550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442753.1)
• Pfam: Di-glucose binding within endoplasmic reticulum (PF11721.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;