Protein coding transcript 130710

• Transcript: Ll_transcript_176570
• CDS coordinates: 200-1330 (+)
• Peptide sequence: MGCTNSKQKKCHKCKSSHSPSLRSKSMHIHHSPLQTEHVVALTSTTLGTLKLNFPSHHDDDDDDSGDGLTFTNDSFFRYKEDKEKKIEKKEEFSMGLIEAKTWSNLIEQKLTKVVTPKTPTKTPPGEPQTIINTWELMEGLEDTSPFRFRNISFDSNAVIDPPKPAMFVEMTQEDESKINNAISEFEPEVLSSLCESFAFSPAADKKFGKDKVVLYFTSLRGVRKTYEDCCKVMSILRGLGVRVDERDVSMHSEFKEELKELLGDGYGVGVGLPRVFVGRSYIGGAEEIQKLHENGKLEKFFASCDKIEDNGSGLCEACGDIKFVACENCYGSRKIYCGSDDDDDDEDVDAMGRYGFQCCPDCNENGLIRCPVCCY*
• ORF Type: complete

Annotations of Ll_transcript_176570

• Blastp: Uncharacterized protein At5g39865 from Arabidopsis with 45.28% of identity
• Blastx: Uncharacterized protein At5g39865 from Arabidopsis with 42.64% of identity
• Eggnog: Glutaredoxin(ENOG4111HAI)
• Kegg: Link to kegg annotations (AT5G39865)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460347.1)
• Pfam: Glutaredoxin (PF00462.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;