Protein coding transcript 130713

• Transcript: Ll_transcript_176579
• CDS coordinates: 123-533 (+)
• Peptide sequence: MSDVEDAVEVGEHGEMYNLLKEVLKNAQVNGSLLHGIHEGTKALEKKLGVLCVLANNCEEAMYKKLVTGLCAENSTPLIEVDSNKTLGEWSGLCKYDNNGQARKVVGCSCVVVKHFGDDTQELDTLLEILKKKNFA*
• ORF Type: complete

Annotations of Ll_transcript_176579

• Blastp: 40S ribosomal protein S12 from Xenopus with 51.54% of identity
• Blastx: 40S ribosomal protein S12 from Xenopus with 51.54% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004507082.1)
• Pfam: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;