Transcript | Ll_transcript_62574 |
---|---|
CDS coordinates | 51-533 (+) |
Peptide sequence | MAQRPVRTPSVPDVSPGVEVSRVDSDLLSPLSLSYDSELPPLPESLSRLSLYDVPPRSKPEPARRHSPKPTELVGSPKQTRQSPIPSEHSDKRPTEKPPVPPRKPSSVDLKLAHLRNEMASLRQMDLQLLSQLRQLNDSISSYRQELIMNMDSYSSSDTDG |
ORF Type | 3prime_partial |
Blastp | Protein FAM89B from Mus with 33.03% of identity |
---|---|
Blastx | Anaphase-promoting complex subunit 11 from Mus with 82.05% of identity |
Eggnog | Family with sequence similarity 89, member(ENOG4112BND) |
Kegg | Link to kegg annotations (17826) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451158.1) |
Pfam | Leucine rich adaptor protein (PF14854.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer