Protein coding transcript 130715

• Transcript: Ll_transcript_165794
• CDS coordinates: 2-523 (+)
• Peptide sequence: DYSDYTVAGETFTLMDGIVGMAHSPRLGQLFYQPLATLKIFSVPTSELVKGPPAEFAPFRVSLAGRKSSQGLGIALNPYDDTLFFSPIVETSVASWNPVTNEQKLLAYDPVALQFPAELRYVAADNSVYILSTRFQKFFLRTVNINEVNLRIIRIQLPKSRPQQSFSNKFFLK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_165794

• Blastp: Major royal jelly protein 2 from Apis with 29.24% of identity
• Blastx: Major royal jelly protein 2 from Apis with 29.24% of identity
• Eggnog: found in the royal jelly which is the food of the queen honey bee larva. The royal jelly determines the development of the young larvae and is responsible for the high reproductive ability of the honeybee queen(ENOG4110SQU)
• Kegg: Link to kegg annotations (406091)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003549219.1)
• Pfam: Major royal jelly protein (PF03022.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;