Transcript | Ll_transcript_165799 |
---|---|
CDS coordinates | 2-472 (+) |
Peptide sequence | EWVSSVTGLPLNTSGDPDNFFEVLKDGQVLCQLVNTLIPGSVKKVNTSAMAFKCMENINNFLAVAVSIGVPSQETFQSVDLWERQNLNSVVICLQSLGRKAGQFGAPSIGPKEAEKNIRNFSEDKLKAGQTIISLQYGSNKGANQSGLNFGNTRHM* |
ORF Type | 5prime_partial |
Blastp | Myophilin from Echinococcus with 45% of identity |
---|---|
Blastx | Myophilin from Echinococcus with 45% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447397.1) |
Pfam | Calponin homology (CH) domain (PF00307.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer