Protein coding transcript 130721

• Transcript: Ll_transcript_165775
• CDS coordinates: 3-377 (+)
• Peptide sequence: WLDSPWSGFFEGKDPLKASKSGVKEETLTHIGKRFSSPPPNAAEFVIHRGIERILKARMQMVENRTVDWALGEAMAFGSLLKDGVHVRLSGQDVERGTFSHRHHVLHHQLVDKATYRPLCNLYPD
• ORF Type: internal

Annotations of Ll_transcript_165775

• Blastp: 2-oxoglutarate dehydrogenase, mitochondrial from Caenorhabditis with 59.84% of identity
• Blastx: 2-oxoglutarate dehydrogenase, mitochondrial from Caenorhabditis with 59.84% of identity
• Eggnog: 2-oxoglutarate dehydrogenase, E1(COG0567)
• Kegg: Link to kegg annotations (CBG01737)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_012568895.1)
• Pfam: Transketolase, pyrimidine binding domain (PF02779.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;