Protein coding transcript 130727

• Transcript: Ll_transcript_199757
• CDS coordinates: 3-326 (+)
• Peptide sequence: EAAMVYDNAAIKLRGPHALTNFITPTHEKRTMTISHGYISGEESHNKTSLCSPTSVLQCYSLTVNDIACEHLCASKNSLETEKHKTESVEEVVGSPNDTVFDIKVSSP
• ORF Type: internal

Annotations of Ll_transcript_199757

• Blastp: Ethylene-responsive transcription factor CRF4 from Arabidopsis with 52.38% of identity
• Blastx: Ethylene-responsive transcription factor CRF4 from Arabidopsis with 52.38% of identity
• Eggnog: Transcription factor(ENOG410YM3E)
• Kegg: Link to kegg annotations (AT4G27950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447160.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;