Protein coding transcript 130729

• Transcript: Ll_transcript_199729
• CDS coordinates: 12-590 (+)
• Peptide sequence: MKLRYRKMGWLKNNGRQILYCLGLLLVLVVEGETLVVPEQKKNCTYFITIETTCTWGAETSNHVSLRFGDTNSNDILVKHLNSKHIRKVDPLEPEVLDDMPRKPFQACMVDQFYVTASCVESPICYLYLKLIGKDDWRPGFAQVRVLEISDLSSGYFYFRRYLPRHVWHGSNVCDSEVTSFGLKKKRMVYGK*
• ORF Type: complete

Annotations of Ll_transcript_199729

• Blastp: Embryo-specific protein ATS3A from Arabidopsis with 31.39% of identity
• Blastx: Embryo-specific protein ATS3A from Arabidopsis with 31.39% of identity
• Eggnog: Embryo-specific protein 3, (ATS3)(ENOG410YRBB)
• Kegg: Link to kegg annotations (AT2G41475)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450731.1)
• Pfam: Embryo-specific protein 3, (ATS3) (PF06232.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;