Protein coding transcript 130731

• Transcript: Ll_transcript_199744
• CDS coordinates: 2-685 (+)
• Peptide sequence: DFLDDITFGFIQINLTDTITVKKPDGSVFSVEIEPVIWSRPIPLAWYFNGQWEDKYGKRWVEALCDNWLKNDRYLKNFAHELPQCPCTLEQALIDKGRFLPDLECDKDTNRDCPFNDKAEHCVKTGSPTVEGAEQQCCYDKNHYLMMSYDQQWGSTPRRCHNLGYLPWNEATKVPTLSQWQYDVMPKYMCCLWQEEQAVGCETLRFERRPTQDCVAYQAPGIAGIYGD
• ORF Type: internal

Annotations of Ll_transcript_199744

• Blastp: Protein mesh from Sophophora with 64.29% of identity
• Blastx: Protein mesh from Sophophora with 64.29% of identity
• Eggnog: sushi domain containing 2(ENOG410YZ7Z)
• Kegg: Link to kegg annotations (Dmel_CG31004)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_012571687.1)
• Pfam: AMOP domain (PF03782.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;