Transcript | Ll_transcript_199744 |
---|---|
CDS coordinates | 2-685 (+) |
Peptide sequence | DFLDDITFGFIQINLTDTITVKKPDGSVFSVEIEPVIWSRPIPLAWYFNGQWEDKYGKRWVEALCDNWLKNDRYLKNFAHELPQCPCTLEQALIDKGRFLPDLECDKDTNRDCPFNDKAEHCVKTGSPTVEGAEQQCCYDKNHYLMMSYDQQWGSTPRRCHNLGYLPWNEATKVPTLSQWQYDVMPKYMCCLWQEEQAVGCETLRFERRPTQDCVAYQAPGIAGIYGD |
ORF Type | internal |
Blastp | Protein mesh from Sophophora with 64.29% of identity |
---|---|
Blastx | Protein mesh from Sophophora with 64.29% of identity |
Eggnog | sushi domain containing 2(ENOG410YZ7Z) |
Kegg | Link to kegg annotations (Dmel_CG31004) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_012571687.1) |
Pfam | AMOP domain (PF03782.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer