Transcript | Ll_transcript_62582 |
---|---|
CDS coordinates | 2-391 (+) |
Peptide sequence | DGVPLIMKCGKALNERKAEIRIQYHDVPGDIFGGVLKRNELVIRVQPDEAVYIKMMTKRPGIGFEMEETELDLTYNNRYKNVKLPDAYERLILDVFCGSQMHFVRADELSEAWRIFTPLLHEIESTQPEP |
ORF Type | internal |
Blastp | Glucose-6-phosphate 1-dehydrogenase from Homo with 79.23% of identity |
---|---|
Blastx | Glucose-6-phosphate 1-dehydrogenase from Homo with 79.23% of identity |
Eggnog | Glucose-6-phosphate 1-dehydrogenase(COG0364) |
Kegg | Link to kegg annotations (2539) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020203853.1) |
Pfam | Glucose-6-phosphate dehydrogenase, C-terminal domain (PF02781.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer