Protein coding transcript 130734

• Transcript: Ll_transcript_265619
• CDS coordinates: 2-478 (+)
• Peptide sequence: TMGNPFVSPLLLLSILMRFGRTIQSYPLILMKELKPGSGLSLLMKRCMELHSGWTGKEGEHEAEKKELVENLKHLENFLGDKAYFGGENFGFVDIAMIPFYKWLSTYEKIGNFKFDCPKIIEWGERCLQNVESVSKFVSDEKDVYELVKAYRNKFDLD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_265619

• Blastp: Probable glutathione S-transferase from Nicotiana with 53.27% of identity
• Blastx: Probable glutathione S-transferase parC from Nicotiana with 53.93% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107782951)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432368.1)
• Pfam: Glutathione S-transferase, C-terminal domain (PF00043.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;