Protein coding transcript 130736

• Transcript: Ll_transcript_265623
• CDS coordinates: 31-648 (+)
• Peptide sequence: MASILRQFAKTLIAPTARNAVALNAVRFKSTEPAEVKETRPTVRKADIAARAQLKDFGKYCADCLPKYIQKVQITAGDELELLIAPEGILPVLQFLKDHHNAQFSNLVDIAGVDVPCRTNRFEIVYNILSLRFNSRIRVKTYTDELTPIDSCNDVYKAANWYEREIWDMYGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVEV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_265623

• Blastp: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial from Homo with 67.17% of identity
• Blastx: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial from Pan with 67.17% of identity
• Eggnog: NDH-1 shuttles electrons from NADH, via FMN and iron- sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity)(COG0852)
• Kegg: Link to kegg annotations (4722)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (YP_009237617.1)
• Pfam: Respiratory-chain NADH dehydrogenase, 30 Kd subunit (PF00329.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;