Protein coding transcript 130737

• Transcript: Ll_transcript_265636
• CDS coordinates: 56-769 (+)
• Peptide sequence: MSNPNRKKSMGRQKLEMKKIAKESNLQVTFTKRRNGLFKKANELCTLCDAQVALIVFSPGNKLFSFGEPSVDAVIRRYLMRDQPQNLENMHFLEANRNANIQELNDKISRINEALEAEKKCSEELARQRKEAQEQFWWAAPIEEMDEDQLDQFKLALENLKKNVLDVVERQNIAQASAADAAAISPPHFFTGGPSPSNNPLQPPTEQFPAYPPPPPPPPHMLQNNPTFNNGPAGGFF*
• ORF Type: complete

Annotations of Ll_transcript_265636

• Blastp: Agamous-like MADS-box protein AGL62 from Arabidopsis with 48.98% of identity
• Blastx: Agamous-like MADS-box protein AGL62 from Arabidopsis with 52.8% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT5G60440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462919.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;