Protein coding transcript 130742

• Transcript: Ll_transcript_265648
• CDS coordinates: 44-475 (+)
• Peptide sequence: MKSLCVAVVLLALSSLVMSASVDEDGIPQAKLLVSKQILNKYLVEDMDIVLKYSLYNVGNSAAVNVALKDKSFPPEVFAVVGGSLDLHVDRIPPGTNVSHIVVVRPRQPGYFNFSAAELSYLASDDAKEPQLAVSSEPGEGGII
• ORF Type: 3prime_partial

Annotations of Ll_transcript_265648

• Blastp: Translocon-associated protein subunit beta from Canis with 49.29% of identity
• Blastx: Translocon-associated protein subunit beta from Bos with 52.17% of identity
• Eggnog: signal sequence receptor, beta (translocon-associated protein beta)(ENOG4111KGI)
• Kegg: Link to kegg annotations (403950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001238351.1)
• Pfam: Translocon-associated protein beta (TRAPB) (PF05753.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;