Protein coding transcript 130743

• Transcript: Ll_transcript_265641
• CDS coordinates: 1-597 (-)
• Peptide sequence: SIFCVFVIIFLLCVLSETAISEDDSEALLALKSSIDVRNTLPWEEGSDVCTWLGVKDCFNGRVRKLVLEYSNLTGTLDSKILNRLDQLRVLSFKGNSLSGQIPNLSGLINLKSLFLNNNNFSGEFPASVTDLHRVKVIVLSGNRISGEIPPSLLKLRRLYVLYLQHNSFTGTIPGFNQTGLRYLNVSKNKLSGEIPVTP
• ORF Type: internal

Annotations of Ll_transcript_265641

• Blastp: Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630 from Arabidopsis with 62.56% of identity
• Blastx: Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630 from Arabidopsis with 62.56% of identity
• Eggnog: inactive leucine-rich repeat receptor-like serine threonine-protein kinase(ENOG410YEDC)
• Kegg: Link to kegg annotations (AT1G60630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413766.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;