Protein coding transcript 130744

• Transcript: Ll_transcript_265632
• CDS coordinates: 2-472 (+)
• Peptide sequence: RARPIATLGLALAIVFVITNPTTASEQCRSGCGKSQDTLKFAVGTTYKYNYHGKVDVSLSSAEGQLITTEVKANVLLTQQAECQQVLQLQNVQIISGGVKKATVIEGLNLPVVINNKDGLVEDHICAEAADTQTSLNIKRAIASAFLVNLKDAHETD
• ORF Type: internal

Annotations of Ll_transcript_265632

• Blastp: Apolipophorins from Locusta with 31.36% of identity
• Blastx: Apolipophorins from Manduca with 30.2% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017433243.1)
• Pfam: Lipoprotein amino terminal region (PF01347.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;